SCOPe 2.08: Domain d2v8qb1: 2v8q B:190-272

Lineage for d2v8qb1 (2v8q B:190-272)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.353: AMPKBI-like [160218] (1 superfamily)
   comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions

4. Superfamily d.353.1: AMPKBI-like [160219] (1 family)
   automatically mapped to Pfam PF04739

5. Family d.353.1.1: AMPKBI-like [160220] (4 proteins)
   Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region

6. Protein 5'-AMP-activated protein kinase subunit beta-2 [160223] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [160224] (1 PDB entry)
   Uniprot O43741 190-272

8. Domain d2v8qb1: 2v8q B:190-272 [152782]
   Other proteins in same PDB: d2v8qa1, d2v8qe1, d2v8qe2
   complexed with amp

Details for d2v8qb1

PDB Entry: 2v8q, 2.1 Å

PDB Description: crystal structure of the regulatory fragment of mammalian ampk in complexes with amp

PDB Compounds: (B:) 5'-amp-activated protein kinase subunit beta-2

SCOPe Domain Sequences for d2v8qb1:

Sequence, based on SEQRES records:

>d2v8qb1 d.353.1.1 (B:190-272) 5'-AMP-activated protein kinase subunit beta-2 {Human (Homo sapiens) [TaxId: 9606]}
gqemyafrseerfksppilpphllqvilnkdtniscdpallpepnhvmlnhlyalsikds
vmvlsathrykkkyvttllykpi

Sequence, based on observed residues (ATOM records):

>d2v8qb1 d.353.1.1 (B:190-272) 5'-AMP-activated protein kinase subunit beta-2 {Human (Homo sapiens) [TaxId: 9606]}
gqemyafrseerfksppilpphllqvilnkdtnpnhvmlnhlyalsikdsvmvlsathry
kkkyvttllykpi

Timeline for d2v8qb1:

• d2v8qb1 first appeared in SCOP 1.75
  
• d2v8qb1 appears in SCOPe 2.07