Lineage for d2v5eb_ (2v5e B:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260390Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2260391Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2260482Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)
  6. 2260580Protein automated matches [190307] (1 species)
    not a true protein
  7. 2260581Species Human (Homo sapiens) [TaxId:9606] [187121] (8 PDB entries)
  8. 2260589Domain d2v5eb_: 2v5e B: [168345]
    automated match to d1agqb_
    complexed with edo, nag, scr

Details for d2v5eb_

PDB Entry: 2v5e (more details), 2.35 Å

PDB Description: the structure of the gdnf:coreceptor complex: insights into ret signalling and heparin binding.
PDB Compounds: (B:) glial cell line-derived neurotrophic factor

SCOPe Domain Sequences for d2v5eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v5eb_ g.17.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrgknrgcvltaihlnvtdlglgyetkeelifrycsgscdaaettydkilknlsrnrrlv
sdkvgqaccrpiafdddlsflddnlvyhilrkhsakrcgci

SCOPe Domain Coordinates for d2v5eb_:

Click to download the PDB-style file with coordinates for d2v5eb_.
(The format of our PDB-style files is described here.)

Timeline for d2v5eb_: