Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (32 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [255553] (3 PDB entries) |
Domain d2v1ob_: 2v1o B: [264513] automated match to d2qq2j_ complexed with coa |
PDB Entry: 2v1o (more details), 1.78 Å
SCOPe Domain Sequences for d2v1ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v1ob_ d.38.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} amrimrpddanvagnvhggtilkmieeagaiistrhcnsqngercvaalarvertdflsp mcigevahvsaeitytskhsvevqvhvmseniltgtkkltnkatlwyvplslknvdkvle vppivylrqeqeeegrkryeaqklerme
Timeline for d2v1ob_: