Lineage for d2v1ob_ (2v1o B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901753Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1901754Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1902478Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 1902479Protein automated matches [190143] (32 species)
    not a true protein
  7. 1902563Species Mouse (Mus musculus) [TaxId:10090] [255553] (3 PDB entries)
  8. 1902565Domain d2v1ob_: 2v1o B: [264513]
    automated match to d2qq2j_
    complexed with coa

Details for d2v1ob_

PDB Entry: 2v1o (more details), 1.78 Å

PDB Description: crystal structure of n-terminal domain of acyl-coa thioesterase 7
PDB Compounds: (B:) cytosolic acyl coenzyme a thioester hydrolase

SCOPe Domain Sequences for d2v1ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v1ob_ d.38.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
amrimrpddanvagnvhggtilkmieeagaiistrhcnsqngercvaalarvertdflsp
mcigevahvsaeitytskhsvevqvhvmseniltgtkkltnkatlwyvplslknvdkvle
vppivylrqeqeeegrkryeaqklerme

SCOPe Domain Coordinates for d2v1ob_:

Click to download the PDB-style file with coordinates for d2v1ob_.
(The format of our PDB-style files is described here.)

Timeline for d2v1ob_: