Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
Species Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId:4932] [54501] (1 PDB entry) |
Domain d2ucza_: 2ucz A: [38330] |
PDB Entry: 2ucz (more details), 2.93 Å
SCOPe Domain Sequences for d2ucza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} sktaqkrllkelqqlikdsppgivagpksennifiwdcliqgppdtpyadgvfnaklefp kdyplsppkltftpsilhpniypngevcisilhspgddpnmyelaeerwspvqsvekill svmsmlsepniesganidacilwrdnrpeferqvklsilkslgf
Timeline for d2ucza_: