Lineage for d2ucz__ (2ucz -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.20: Ubiquitin conjugating enzyme [54494] (1 superfamily) Superfamily d.20.1: Ubiquitin conjugating enzyme [54495] (1 family) 
Family d.20.1.1: Ubiquitin conjugating enzyme [54496] (1 protein) Protein Ubiquitin conjugating enzyme [54497] (7 species) 
Species Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId:4932] [54501] (1 PDB entry) 
Domain d2ucz__: 2ucz - [38330]
Details for d2ucz__
PDB Entry: 2ucz (more details), 2.93 Å
PDB Description: ubiquitin conjugating enzyme (ubc7) from saccharomyces cerevisiae
SCOP Domain Sequences for d2ucz__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ucz__ d.20.1.1 (-) Ubiquitin conjugating enzyme {Baker's yeast (Saccharomyces cerevisiae), ubc7}
sktaqkrllkelqqlikdsppgivagpksennifiwdcliqgppdtpyadgvfnaklefp
kdyplsppkltftpsilhpniypngevcisilhspgddpnmyelaeerwspvqsvekill
svmsmlsepniesganidacilwrdnrpeferqvklsilkslgf
SCOP Domain Coordinates for d2ucz__:
Click to download the PDB-style file with coordinates for d2ucz__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ucz__:
- d2ucz__ appears in SCOP 1.57
- d2ucz__ appears in the current release, SCOPe 2.08, called d2ucza_
View in 3D