Lineage for d2rkua_ (2rku A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2591262Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2591263Protein automated matches [190417] (35 species)
    not a true protein
  7. 2591422Species Human (Homo sapiens) [TaxId:9606] [187294] (1319 PDB entries)
  8. 2592174Domain d2rkua_: 2rku A: [206163]
    automated match to d2bvab_
    complexed with r78, srt, tar, tla, zn

Details for d2rkua_

PDB Entry: 2rku (more details), 1.95 Å

PDB Description: structure of plk1 in complex with bi2536
PDB Compounds: (A:) Serine/threonine-protein kinase PLK1

SCOPe Domain Sequences for d2rkua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rkua_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akeipevlvdprsrrryvrgrflgkggfakcfeisdadtkevfagkivpkslllkphqre
kmsmeisihrslahqhvvgfhgffedndfvfvvlelcrrrsllelhkrrkaltepearyy
lrqivlgcqylhrnrvihrdlklgnlflnedlevkigdfglatkveydgerkkvlcgtpn
yiapevlskkghsfevdvwsigcimytllvgkppfetsclketylrikkneysipkhinp
vaasliqkmlqtdptarptinellndefftsgyiparlpitcltipprfsiaps

SCOPe Domain Coordinates for d2rkua_:

Click to download the PDB-style file with coordinates for d2rkua_.
(The format of our PDB-style files is described here.)

Timeline for d2rkua_: