Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (84 species) not a true protein |
Species Neptuniibacter caesariensis [TaxId:207954] [225361] (1 PDB entry) |
Domain d2rjna_: 2rjn A: [206138] automated match to d1qkka_ |
PDB Entry: 2rjn (more details), 2.1 Å
SCOPe Domain Sequences for d2rjna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rjna_ c.23.1.0 (A:) automated matches {Neptuniibacter caesariensis [TaxId: 207954]} nyknytvmlvddeqpilnslkrlikrlgcniitftspldalealkgtsvqlvisdmrmpe mggevfleqvaksypdiervvisgyadaqatidavnrgkisrfllkpwededvfkvvekg lqlaflreenlrlqe
Timeline for d2rjna_: