Lineage for d2rjna_ (2rjn A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2464082Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2464083Protein automated matches [190131] (84 species)
    not a true protein
  7. 2464318Species Neptuniibacter caesariensis [TaxId:207954] [225361] (1 PDB entry)
  8. 2464319Domain d2rjna_: 2rjn A: [206138]
    automated match to d1qkka_

Details for d2rjna_

PDB Entry: 2rjn (more details), 2.1 Å

PDB Description: crystal structure of an uncharacterized protein q2bku2 from neptuniibacter caesariensis
PDB Compounds: (A:) Response regulator receiver:Metal-dependent phosphohydrolase, HD subdomain

SCOPe Domain Sequences for d2rjna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rjna_ c.23.1.0 (A:) automated matches {Neptuniibacter caesariensis [TaxId: 207954]}
nyknytvmlvddeqpilnslkrlikrlgcniitftspldalealkgtsvqlvisdmrmpe
mggevfleqvaksypdiervvisgyadaqatidavnrgkisrfllkpwededvfkvvekg
lqlaflreenlrlqe

SCOPe Domain Coordinates for d2rjna_:

Click to download the PDB-style file with coordinates for d2rjna_.
(The format of our PDB-style files is described here.)

Timeline for d2rjna_: