Lineage for d2reba1 (2reb A:3-268)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) 
division into families based on beta-sheet topologies
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
Protein RecA protein, ATPase-domain [52671] (6 species)
C-terminal domain is alpha+betaSpecies Escherichia coli [TaxId:562] [52672] (7 PDB entries)
Uniprot P0A7G6 P03017
Domain d2reba1: 2reb A:3-268 [32282]
Other proteins in same PDB: d2reba2
Details for d2reba1
PDB Entry: 2reb (more details), 2.3 Å
PDB Description: the structure of the e. coli reca protein monomer and polymer
PDB Compounds: (A:) rec aSCOPe Domain Sequences for d2reba1:
Sequence, based on SEQRES records: (download)
>d2reba1 c.37.1.11 (A:3-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]}
denkqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgriv
eiygpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpdtg
eqaleicdalarsgavdvivvdsvaaltpkaeiegeigdshmglaarmmsqamrklagnl
kqsntllifinqirmkigvmfgnpetttggnalkfyasvrldirrigavkegenvvgset
rvkvvknkiaapfkqaefqilygegi
Sequence, based on observed residues (ATOM records): (download)
>d2reba1 c.37.1.11 (A:3-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]}
denkqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgriv
eiygpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpdtg
eqaleicdalarsgavdvivvdsvaaltpkaeieglaarmmsqamrklagnlkqsntlli
finqtggnalkfyasvrldirrigavkegenvvgsetrvkvvknkiaapfkqaefqilyg
egi
SCOPe Domain Coordinates for d2reba1:
Click to download the PDB-style file with coordinates for d2reba1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2reba1:
- d2reba1 first appeared (with stable ids) in SCOP 1.55, called d2reb_1
- d2reba1 appears in SCOPe 2.05
- d2reba1 appears in SCOPe 2.07
- d2reba1 appears in the current release, SCOPe 2.08
View in 3D
