Lineage for d2r4qa1 (2r4q A:171-273)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1599665Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 1599779Superfamily c.44.2: PTS system IIB component-like [52794] (3 families) (S)
  5. 1599794Family c.44.2.2: PTS system, Fructose specific IIB subunit-like [159584] (2 proteins)
    Pfam PF02379
  6. 1599795Protein Fructose-specific enzyme IIABC component FruA, middle domain [159585] (1 species)
  7. 1599796Species Bacillus subtilis [TaxId:1423] [159586] (1 PDB entry)
    Uniprot P71012 171-273
  8. 1599797Domain d2r4qa1: 2r4q A:171-273 [151580]

Details for d2r4qa1

PDB Entry: 2r4q (more details), 1.6 Å

PDB Description: the structure of a domain of frua from bacillus subtilis
PDB Compounds: (A:) Phosphotransferase system (PTS) fructose-specific enzyme IIABC component

SCOPe Domain Sequences for d2r4qa1:

Sequence, based on SEQRES records: (download)

>d2r4qa1 c.44.2.2 (A:171-273) Fructose-specific enzyme IIABC component FruA, middle domain {Bacillus subtilis [TaxId: 1423]}
kilavtacptgiahtfmaadalkekakelgveikvetngssgikhkltaqeiedapaiiv
aadkqvemerfkgkrvlqvpvtagirrpqeliekamnqdapiy

Sequence, based on observed residues (ATOM records): (download)

>d2r4qa1 c.44.2.2 (A:171-273) Fructose-specific enzyme IIABC component FruA, middle domain {Bacillus subtilis [TaxId: 1423]}
kilavtacptghtfmaadalkekakelgveikvetngssgikhkltaqeiedapaiivaa
dkqvemerfkgkrvlqvpvtagirrpqeliekamnqdapiy

SCOPe Domain Coordinates for d2r4qa1:

Click to download the PDB-style file with coordinates for d2r4qa1.
(The format of our PDB-style files is described here.)

Timeline for d2r4qa1: