![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
![]() | Protein automated matches [190438] (36 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187421] (100 PDB entries) |
![]() | Domain d2qxia_: 2qxi A: [167868] automated match to d1npma_ complexed with k7j |
PDB Entry: 2qxi (more details), 1 Å
SCOPe Domain Sequences for d2qxia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qxia_ b.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} iidgapcargshpwqvallsgnqlhcggvlvnerwvltaahckmneytvhlgsdtlgdrr aqrikasksfrhpgystqthvndlmlvklnsqarlssmvkkvrlpsrceppgttctvsgw gtttspdvtfpsdlmcvdvklispqdctkvykdllensmlcagipdskknacngdsggpl vcrgtlqglvswgtfpcgqpndpgvytqvckftkwindtmkkhr
Timeline for d2qxia_: