Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.224: SufE/NifU [82648] (1 superfamily) alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123 |
Superfamily d.224.1: SufE/NifU [82649] (4 families) iron-sulfur cluster assembly proteins |
Family d.224.1.0: automated matches [191547] (1 protein) not a true family |
Protein automated matches [190942] (7 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [188505] (1 PDB entry) |
Domain d2qq4f_: 2qq4 F: [167768] automated match to d1xjsa_ complexed with zn |
PDB Entry: 2qq4 (more details), 1.85 Å
SCOPe Domain Sequences for d2qq4f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qq4f_ d.224.1.0 (F:) automated matches {Thermus thermophilus [TaxId: 274]} vldelyreilldhyqsprnfgvlpqatkqaggmnpscgdqvevmvllegdtiadirfqgq gcaistasaslmteavkgkkvaealelsrkfqamvvegappdptlgdllalqgvaklpar vkcatlawhaleealr
Timeline for d2qq4f_: