Lineage for d2qlgb_ (2qlg B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.22: GFP-like [54510] (1 superfamily)
beta-sheet folds into a barrel (n=11, S=14) around the central helixSuperfamily d.22.1: GFP-like [54511] (3 families) 
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) 
Protein automated matches [190406] (19 species)
not a true protein
Species Discosoma sp. [TaxId:301246] [188540] (5 PDB entries) 
Domain d2qlgb_: 2qlg B: [167708]
automated match to d1g7ka_
Details for d2qlgb_
PDB Entry: 2qlg (more details), 1.8 Å
PDB Description: mPlum
PDB Compounds: (B:) Fluorescent protein plumSCOPe Domain Sequences for d2qlgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qlgb_ d.22.1.1 (B:) automated matches {Discosoma sp. [TaxId: 301246]}
evikefmrfkehmegsvnghefeiegegegrpyegtqtarlkvtkggplpfawdilspqi
mygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvkvr
gtnfpsdgpvmqkktmgweassermypedgalkgemkmrlrlkdgghydaevkttymakk
pvqlpgayktdiklditshnedytiveqyeraegrhstg
SCOPe Domain Coordinates for d2qlgb_:
Click to download the PDB-style file with coordinates for d2qlgb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2qlgb_:
- d2qlgb_ first appeared in SCOPe 2.01
- d2qlgb_ appears in SCOPe 2.07
View in 3D
