Lineage for d2qfra1 (2qfr A:9-120)
- Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (1 family) 
Family b.1.12.1: Purple acid phosphatase, N-terminal domain [49364] (1 protein) Protein Purple acid phosphatase, N-terminal domain [49365] (2 species) Species Kidney bean (Phaseolus vulgaris) [TaxId:3885] [49366] (5 PDB entries) 
Domain d2qfra1: 2qfr A:9-120 [150750]
Other proteins in same PDB: d2qfra2, d2qfrb2
automatically matched to d1kbpa1
complexed with fe, nag, ndg, so4, zn
Details for d2qfra1
PDB Entry: 2qfr (more details), 2.4 Å
PDB Description: crystal structure of red kidney bean purple acid phosphatase with bound sulfate
PDB Compounds: (A:) purple acid phosphataseSCOP Domain Sequences for d2qfra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}
rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp
SCOP Domain Coordinates for d2qfra1:
Click to download the PDB-style file with coordinates for d2qfra1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2qfra1:
- d2qfra1 is new in SCOP 1.75
- d2qfra1 appears in SCOPe 2.01
- d2qfra1 appears in the current release, SCOPe 2.08
View in 3D
