SCOPe 2.08: Domain d2qfra1: 2qfr A:9-120

Lineage for d2qfra1 (2qfr A:9-120)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families)

5. Family b.1.12.0: automated matches [227279] (1 protein)
   not a true family

6. Protein automated matches [227090] (1 species)
   not a true protein

7. Species French bean (Phaseolus vulgaris) [TaxId:3885] [226471] (11 PDB entries)

8. Domain d2qfra1: 2qfr A:9-120 [150750]
   Other proteins in same PDB: d2qfra2, d2qfrb2
   automated match to d2qfra1
   complexed with fe, nag, ndg, so4, zn

Details for d2qfra1

PDB Entry: 2qfr, 2.4 Å

PDB Description: crystal structure of red kidney bean purple acid phosphatase with bound sulfate

PDB Compounds: (A:) purple acid phosphatase

SCOPe Domain Sequences for d2qfra1:

Sequence; same for both SEQRES and ATOM records:

>d2qfra1 b.1.12.0 (A:9-120) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

Timeline for d2qfra1:

• d2qfra1 first appeared in SCOP 1.75
  
• d2qfra1 appears in SCOPe 2.07