Lineage for d2pzza1 (2pzz A:2-134)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1209370Fold d.77: RL5-like [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 1209371Superfamily d.77.1: RL5-like [55282] (3 families) (S)
  5. 1209463Family d.77.1.2: SSO1042-like [160489] (5 proteins)
    Pfam PF01877; DUF54
  6. 1209464Protein Hypotheical protein MJ1564 [160496] (1 species)
  7. 1209465Species Methanocaldococcus jannaschii [TaxId:2190] [160497] (1 PDB entry)
    Uniprot Q58959 1-133
  8. 1209466Domain d2pzza1: 2pzz A:2-134 [149977]

Details for d2pzza1

PDB Entry: 2pzz (more details), 2.2 Å

PDB Description: 2.2 a resolution crystal structure of upf0201 protein from methanococcus jannaschii
PDB Compounds: (A:) UPF0201 protein MJ1564

SCOPe Domain Sequences for d2pzza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pzza1 d.77.1.2 (A:2-134) Hypotheical protein MJ1564 {Methanocaldococcus jannaschii [TaxId: 2190]}
leviikakvkptedkykvkkailnifpkakltfiekdnefgewegktksveklkellrsq
sildaarmvlekgmtenatkfylnkqaayvgavnfdidthggifvkiladenedimkiik
diaprtkggviin

SCOPe Domain Coordinates for d2pzza1:

Click to download the PDB-style file with coordinates for d2pzza1.
(The format of our PDB-style files is described here.)

Timeline for d2pzza1: