Lineage for d2pzaa_ (2pza A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) 
share similar mode of ligand (Adenosine group) binding
can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other groupFamily c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins) Protein NH3-dependent NAD+-synthetase [52406] (4 species) 
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188002] (3 PDB entries) 
Domain d2pzaa_: 2pza A: [167358]
automated match to d1ee1a_
complexed with amp, gol, mg, pop
Details for d2pzaa_
PDB Entry: 2pza (more details), 2.4 Å
PDB Description: NAD+ Synthetase from Bacillus anthracis with AMP + PPi and Mg2+
PDB Compounds: (A:) nh(3)-dependent nad(+) synthetaseSCOPe Domain Sequences for d2pzaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pzaa_ c.26.2.1 (A:) NH3-dependent NAD+-synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mtlqeqimkalhvqpvidpkaeirkrvdflkdyvkktgakgfvlgisggqdstlagrlaq
laveeirneggnatfiavrlpykvqkdeddaqlalqfiqadqsvafdiastvdafsnqye
nlldesltdfnkgnvkarirmvtqyaiggqkgllvigtdhaaeavtgfftkfgdggadll
pltgltkrqgrallqelgaderlylkmptadlldekpgqadetelgitydqlddylegkt
vpadvaekiekrytvsehkrqvpasmfddwwklaaaleh
SCOPe Domain Coordinates for d2pzaa_:
Click to download the PDB-style file with coordinates for d2pzaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2pzaa_:
- d2pzaa_ first appeared in SCOPe 2.01
- d2pzaa_ appears in SCOPe 2.04
- d2pzaa_ is called d2pzaa1 in SCOPe 2.06
- d2pzaa_ appears in the current release, SCOPe 2.08, called d2pzaa1
View in 3D
