Lineage for d2pzaa1 (2pza A:1-272)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861264Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)
  6. 2861350Protein NH3-dependent NAD+-synthetase [52406] (4 species)
  7. 2861351Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188002] (3 PDB entries)
  8. 2861358Domain d2pzaa1: 2pza A:1-272 [167358]
    Other proteins in same PDB: d2pzaa2, d2pzab2
    automated match to d1ee1a_
    complexed with amp, gol, mg, pop

    has additional insertions and/or extensions that are not grouped together

Details for d2pzaa1

PDB Entry: 2pza (more details), 2.4 Å

PDB Description: NAD+ Synthetase from Bacillus anthracis with AMP + PPi and Mg2+
PDB Compounds: (A:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d2pzaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pzaa1 c.26.2.1 (A:1-272) NH3-dependent NAD+-synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mtlqeqimkalhvqpvidpkaeirkrvdflkdyvkktgakgfvlgisggqdstlagrlaq
laveeirneggnatfiavrlpykvqkdeddaqlalqfiqadqsvafdiastvdafsnqye
nlldesltdfnkgnvkarirmvtqyaiggqkgllvigtdhaaeavtgfftkfgdggadll
pltgltkrqgrallqelgaderlylkmptadlldekpgqadetelgitydqlddylegkt
vpadvaekiekrytvsehkrqvpasmfddwwk

SCOPe Domain Coordinates for d2pzaa1:

Click to download the PDB-style file with coordinates for d2pzaa1.
(The format of our PDB-style files is described here.)

Timeline for d2pzaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pzaa2