Lineage for d2pqma_ (2pqm A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) 
Family c.79.1.0: automated matches [191338] (1 protein)
not a true familyProtein automated matches [190215] (23 species)
not a true protein
Species Entamoeba histolytica [TaxId:294381] [225437] (5 PDB entries) 
Domain d2pqma_: 2pqm A: [231167]
automated match to d4jbla_
complexed with plp, so4
Details for d2pqma_
PDB Entry: 2pqm (more details), 1.86 Å
PDB Description: Crystal structure of Cysteine Synthase (OASS) from Entamoeba histolytica at 1.86 A resolution
PDB Compounds: (A:) Cysteine synthaseSCOPe Domain Sequences for d2pqma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pqma_ c.79.1.0 (A:) automated matches {Entamoeba histolytica [TaxId: 294381]}
eqisissprkriyhniletiggtplvelhgvtehprikkgtrilvkleyfnpmssvkdrv
gfnivyqaikdgrlkpgmeiiestsgntgialcqagavfgyrvniampstmsverqmimk
afgaeliltegkkgmpgaieevnkmikenpgkyfvanqfgnpdntaahhytaneiwedtd
gevdivvsavgtsgtvigvaeklkekkkgikiiavepeesavlegkakgphgiqgigagf
ipdiykkefvdeiipiktqdawkmaravvkydgimcgmssgaailaglkeaekpenegkt
iviivpscgerylstdlykikdegtkiqildsllnehh
SCOPe Domain Coordinates for d2pqma_:
Click to download the PDB-style file with coordinates for d2pqma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2pqma_:
- d2pqma_ first appeared in SCOPe 2.03
- d2pqma_ appears in SCOPe 2.04
- d2pqma_ is called d2pqma1 in SCOPe 2.06
- d2pqma_ appears in the current release, SCOPe 2.08, called d2pqma1
View in 3D
