| Root: SCOPe 2.08 |
| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) ![]() |
| Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
| Protein automated matches [190215] (38 species) not a true protein |
| Species Entamoeba histolytica [TaxId:294381] [225437] (5 PDB entries) |
| Domain d2pqma1: 2pqm A:2-337 [231167] Other proteins in same PDB: d2pqma2 automated match to d4jbla_ complexed with plp, so4 |
PDB Entry: 2pqm (more details), 1.86 Å
SCOPe Domain Sequences for d2pqma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pqma1 c.79.1.0 (A:2-337) automated matches {Entamoeba histolytica [TaxId: 294381]}
eqisissprkriyhniletiggtplvelhgvtehprikkgtrilvkleyfnpmssvkdrv
gfnivyqaikdgrlkpgmeiiestsgntgialcqagavfgyrvniampstmsverqmimk
afgaeliltegkkgmpgaieevnkmikenpgkyfvanqfgnpdntaahhytaneiwedtd
gevdivvsavgtsgtvigvaeklkekkkgikiiavepeesavlegkakgphgiqgigagf
ipdiykkefvdeiipiktqdawkmaravvkydgimcgmssgaailaglkeaekpenegkt
iviivpscgerylstdlykikdegtkiqildsllne
Timeline for d2pqma1: