| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (239 species) not a true protein |
| Species Aneurinibacillus thermoaerophilus [TaxId:143495] [225432] (1 PDB entry) |
| Domain d2pk3a_: 2pk3 A: [205535] automated match to d1r66a_ complexed with a2r, gdd |
PDB Entry: 2pk3 (more details), 1.82 Å
SCOPe Domain Sequences for d2pk3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pk3a_ c.2.1.0 (A:) automated matches {Aneurinibacillus thermoaerophilus [TaxId: 143495]}
mralitgvagfvgkylanhlteqnvevfgtsrnneaklpnvemisldimdsqrvkkvisd
ikpdyifhlaakssvkdswlnkkgtfstnvfgtlhvldavrdsnldcriltigsseeygm
ilpeespvseenqlrpmspygvskasvgmlarqyvkaygmdiihtrtfnhigpgqslgfv
tqdfakqivdiemekqepiikvgnleavrdftdvrdivqaywllsqygktgdvynvcsgi
gtriqdvldlllamanvkidtelnplqlrpsevptligsnkrlkdstgwkpriplekslf
eilqsyrqa
Timeline for d2pk3a_: