![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.4: Electron transport chains [58146] (1 superfamily) |
![]() | Superfamily i.4.1: Electron transport chains [58147] (1 family) ![]() |
![]() | Family i.4.1.1: Electron transport chains [58148] (3 proteins) not a true family |
![]() | Protein Cytochrome f-plastocyanin complex [58149] (2 species) |
![]() | Species Plant (Spinacia oleracea) and (Brassica rapa) [TaxId:3562] [58150] (1 PDB entry) |
![]() | Domain d2pcfb_: 2pcf B: [45911] complexed with cu, hec |
PDB Entry: 2pcf (more details)
SCOPe Domain Sequences for d2pcfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pcfb_ i.4.1.1 (B:) Cytochrome f-plastocyanin complex {Plant (Spinacia oleracea) and (Brassica rapa) [TaxId: 3562]} ypifaqqnyenpreatgrivcanchlaskpvdievpqavlpdtvfeavvkipydmqlkqv langkkgalnvgavlilpegfelappdrispemkekignlsfqnyrpnkknilvigpvpg qkyseitfpilapdpatnkdvhflkypiyvggnrgrgqiypdgsksnntvynataggiis kilrkekggyeitivdasnerqvidiiprglellvsegesikldqpltsnpnvggfgqgd aeivlqdplr
Timeline for d2pcfb_: