Lineage for d2pcfb_ (2pcf B:)
- Root: SCOPe 2.08
Class i: Low resolution protein structures [58117] (25 folds) 
Fold i.4: Electron transport chains [58146] (1 superfamily) Superfamily i.4.1: Electron transport chains [58147] (1 family) 
Family i.4.1.1: Electron transport chains [58148] (3 proteins)
not a true familyProtein Cytochrome f-plastocyanin complex [58149] (2 species) 
Species Plant (Spinacia oleracea) and (Brassica rapa) [TaxId:3562] [58150] (1 PDB entry) 
Domain d2pcfb_: 2pcf B: [45911]
complexed with cu, hec
Details for d2pcfb_
PDB Entry: 2pcf (more details)
PDB Description: the complex of cytochrome f and plastocyanin determined with paramagnetic nmr. based on the structures of cytochrome f and plastocyanin, 10 structures
PDB Compounds: (B:) cytochrome fSCOPe Domain Sequences for d2pcfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pcfb_ i.4.1.1 (B:) Cytochrome f-plastocyanin complex {Plant (Spinacia oleracea) and (Brassica rapa) [TaxId: 3562]}
ypifaqqnyenpreatgrivcanchlaskpvdievpqavlpdtvfeavvkipydmqlkqv
langkkgalnvgavlilpegfelappdrispemkekignlsfqnyrpnkknilvigpvpg
qkyseitfpilapdpatnkdvhflkypiyvggnrgrgqiypdgsksnntvynataggiis
kilrkekggyeitivdasnerqvidiiprglellvsegesikldqpltsnpnvggfgqgd
aeivlqdplr
SCOPe Domain Coordinates for d2pcfb_:
Click to download the PDB-style file with coordinates for d2pcfb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2pcfb_:
- d2pcfb_ first appeared (with stable ids) in SCOP 1.55
- d2pcfb_ appears in SCOPe 2.07
View in 3D
