Lineage for d2pcfa_ (2pcf A:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3044316Fold i.4: Electron transport chains [58146] (1 superfamily)
  4. 3044317Superfamily i.4.1: Electron transport chains [58147] (1 family) (S)
  5. 3044318Family i.4.1.1: Electron transport chains [58148] (3 proteins)
    not a true family
  6. 3044319Protein Cytochrome f-plastocyanin complex [58149] (2 species)
  7. 3044322Species Plant (Spinacia oleracea) and (Brassica rapa) [TaxId:3562] [58150] (1 PDB entry)
  8. 3044323Domain d2pcfa_: 2pcf A: [45910]
    complexed with cu, hec

Details for d2pcfa_

PDB Entry: 2pcf (more details)

PDB Description: the complex of cytochrome f and plastocyanin determined with paramagnetic nmr. based on the structures of cytochrome f and plastocyanin, 10 structures
PDB Compounds: (A:) plastocyanin

SCOPe Domain Sequences for d2pcfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pcfa_ i.4.1.1 (A:) Cytochrome f-plastocyanin complex {Plant (Spinacia oleracea) and (Brassica rapa) [TaxId: 3562]}
vevllgggdgslaflpgdfsvasgeeivfknnagfphnvvfdedeipsgvdaakismsee
dllnapgetykvtltekgtykfycsphqgagmvgkvtvn

SCOPe Domain Coordinates for d2pcfa_:

Click to download the PDB-style file with coordinates for d2pcfa_.
(The format of our PDB-style files is described here.)

Timeline for d2pcfa_: