Lineage for d2p61a1 (2p61 A:34-152)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765368Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 766013Superfamily a.24.29: TM1646-like [158397] (1 family) (S)
  5. 766014Family a.24.29.1: TM1646-like [158398] (1 protein)
    Pfam PF03885; DUF327
  6. 766015Protein Hypothetical protein TM1646 [158399] (1 species)
  7. 766016Species Thermotoga maritima [TaxId:2336] [158400] (1 PDB entry)
    Uniprot Q9X1X9 34-152
  8. 766017Domain d2p61a1: 2p61 A:34-152 [149266]

Details for d2p61a1

PDB Entry: 2p61 (more details), 2.7 Å

PDB Description: crystal structure of protein tm1646 from thermotoga maritima, pfam duf327
PDB Compounds: (A:) Hypothetical protein TM_1646

SCOP Domain Sequences for d2p61a1:

Sequence, based on SEQRES records: (download)

>d2p61a1 a.24.29.1 (A:34-152) Hypothetical protein TM1646 {Thermotoga maritima [TaxId: 2336]}
effdiledvkedhfeklleeaveevidsgnelvrsptpsnlkryknaikeflkliekkiy
klagsfdmnsgrarlhlvveevneklmdltekimknewqtinlaarieeinglilnlyr

Sequence, based on observed residues (ATOM records): (download)

>d2p61a1 a.24.29.1 (A:34-152) Hypothetical protein TM1646 {Thermotoga maritima [TaxId: 2336]}
effdiledvkedhfeklleeaveevidsgnelvrsptpsnlkryknaikeflkliekkiy
klnsgrarlhlvveevneklmdltekimknewqtinlaarieeinglilnlyr

SCOP Domain Coordinates for d2p61a1:

Click to download the PDB-style file with coordinates for d2p61a1.
(The format of our PDB-style files is described here.)

Timeline for d2p61a1: