Lineage for d2p3ya1 (2p3y A:22-482)
- Root: SCOPe 2.03
Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) 
Fold e.65: VPA0735-like [160934] (1 superfamily)
consists of a cluster of helices and two beta-sandwich domains of similar topology; probable duplicationSuperfamily e.65.1: VPA0735-like [160935] (1 family) 
Family e.65.1.1: VPA0735-like [160936] (1 protein)
the N-terminal beta-sandwich domain corresponds to Pfam PF06863 (DUF1254); the C-terminal beta-sandwich domains corresponds to Pfam PF06742 (DUF1214); the two Pfam families are structurally relatedProtein Hypothetical protein VPA0735 [160937] (1 species) Species Vibrio parahaemolyticus [TaxId:670] [160938] (2 PDB entries)
Uniprot Q87I71 22-482
Domain d2p3ya1: 2p3y A:22-482 [149190]
Details for d2p3ya1
PDB Entry: 2p3y (more details), 1.8 Å
PDB Description: crystal structure of vpa0735 from vibrio parahaemolyticus. northeast structural genomics target vpr109
PDB Compounds: (A:) Hypothetical protein VPA0735SCOPe Domain Sequences for d2p3ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p3ya1 e.65.1.1 (A:22-482) Hypothetical protein VPA0735 {Vibrio parahaemolyticus [TaxId: 670]}
qetvvpsrvgdlkfesdfptqetmknmlnemdfqratqaylwgipassimewlnvsrndf
kfeegqmgffntlkqkqgiitanfttpyvigtwnlektgpliinlpeakmagmmldvhqr
vlsdlsllgpdkgkggkylivppgekykdlnpkgyyvirpktnvvyggirilepdvdrvv
kqvvpnittqpyadgklgrkipvaqvpeidwthipkdgleywktihqiiqenpveerdrf
vmaqlkflgiekgkpfnpteeqkkilleaskvgramaqsndytkrftqpywkgtnwkdai
svsldqrsenydelderaawfyeaitvsrgmkstipgfgqrylvtyqdsdgnwlsgehty
klhvpanvpasnfwsttvydennrlmiindagspdissrknlkvnsdgsidvyygpkpvk
gyennwvqtnpgegwftyfrfygptekmfdkswtmgdielv
SCOPe Domain Coordinates for d2p3ya1:
Click to download the PDB-style file with coordinates for d2p3ya1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2p3ya1:
- d2p3ya1 first appeared in SCOP 1.75
- d2p3ya1 appears in SCOPe 2.02
- d2p3ya1 appears in SCOPe 2.04
- d2p3ya1 appears in the current release, SCOPe 2.08
View in 3D
