Lineage for d2p3ya1 (2p3y A:22-482)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3020688Fold e.65: VPA0735-like [160934] (1 superfamily)
    consists of a cluster of helices and two beta-sandwich domains of similar topology; probable duplication
  4. 3020689Superfamily e.65.1: VPA0735-like [160935] (1 family) (S)
  5. 3020690Family e.65.1.1: VPA0735-like [160936] (1 protein)
    the N-terminal beta-sandwich domain corresponds to Pfam PF06863 (DUF1254); the C-terminal beta-sandwich domains corresponds to Pfam PF06742 (DUF1214); the two Pfam families are structurally related
  6. 3020691Protein Hypothetical protein VPA0735 [160937] (1 species)
  7. 3020692Species Vibrio parahaemolyticus [TaxId:670] [160938] (2 PDB entries)
    Uniprot Q87I71 22-482
  8. 3020697Domain d2p3ya1: 2p3y A:22-482 [149190]

Details for d2p3ya1

PDB Entry: 2p3y (more details), 1.8 Å

PDB Description: crystal structure of vpa0735 from vibrio parahaemolyticus. northeast structural genomics target vpr109
PDB Compounds: (A:) Hypothetical protein VPA0735

SCOPe Domain Sequences for d2p3ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p3ya1 e.65.1.1 (A:22-482) Hypothetical protein VPA0735 {Vibrio parahaemolyticus [TaxId: 670]}
qetvvpsrvgdlkfesdfptqetmknmlnemdfqratqaylwgipassimewlnvsrndf
kfeegqmgffntlkqkqgiitanfttpyvigtwnlektgpliinlpeakmagmmldvhqr
vlsdlsllgpdkgkggkylivppgekykdlnpkgyyvirpktnvvyggirilepdvdrvv
kqvvpnittqpyadgklgrkipvaqvpeidwthipkdgleywktihqiiqenpveerdrf
vmaqlkflgiekgkpfnpteeqkkilleaskvgramaqsndytkrftqpywkgtnwkdai
svsldqrsenydelderaawfyeaitvsrgmkstipgfgqrylvtyqdsdgnwlsgehty
klhvpanvpasnfwsttvydennrlmiindagspdissrknlkvnsdgsidvyygpkpvk
gyennwvqtnpgegwftyfrfygptekmfdkswtmgdielv

SCOPe Domain Coordinates for d2p3ya1:

Click to download the PDB-style file with coordinates for d2p3ya1.
(The format of our PDB-style files is described here.)

Timeline for d2p3ya1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2p3yb_