SCOPe 2.08: Domain d2p3ya1: 2p3y A:22-482

Lineage for d2p3ya1 (2p3y A:22-482)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.65: VPA0735-like [160934] (1 superfamily)
   consists of a cluster of helices and two beta-sandwich domains of similar topology; probable duplication

4. Superfamily e.65.1: VPA0735-like [160935] (1 family)

5. Family e.65.1.1: VPA0735-like [160936] (1 protein)
   the N-terminal beta-sandwich domain corresponds to Pfam PF06863 (DUF1254); the C-terminal beta-sandwich domains corresponds to Pfam PF06742 (DUF1214); the two Pfam families are structurally related

6. Protein Hypothetical protein VPA0735 [160937] (1 species)

7. Species Vibrio parahaemolyticus [TaxId:670] [160938] (2 PDB entries)
   Uniprot Q87I71 22-482

8. Domain d2p3ya1: 2p3y A:22-482 [149190]

Details for d2p3ya1

PDB Entry: 2p3y, 1.8 Å

PDB Description: crystal structure of vpa0735 from vibrio parahaemolyticus. northeast structural genomics target vpr109

PDB Compounds: (A:) Hypothetical protein VPA0735

SCOPe Domain Sequences for d2p3ya1:

Sequence; same for both SEQRES and ATOM records:

>d2p3ya1 e.65.1.1 (A:22-482) Hypothetical protein VPA0735 {Vibrio parahaemolyticus [TaxId: 670]}
qetvvpsrvgdlkfesdfptqetmknmlnemdfqratqaylwgipassimewlnvsrndf
kfeegqmgffntlkqkqgiitanfttpyvigtwnlektgpliinlpeakmagmmldvhqr
vlsdlsllgpdkgkggkylivppgekykdlnpkgyyvirpktnvvyggirilepdvdrvv
kqvvpnittqpyadgklgrkipvaqvpeidwthipkdgleywktihqiiqenpveerdrf
vmaqlkflgiekgkpfnpteeqkkilleaskvgramaqsndytkrftqpywkgtnwkdai
svsldqrsenydelderaawfyeaitvsrgmkstipgfgqrylvtyqdsdgnwlsgehty
klhvpanvpasnfwsttvydennrlmiindagspdissrknlkvnsdgsidvyygpkpvk
gyennwvqtnpgegwftyfrfygptekmfdkswtmgdielv

Timeline for d2p3ya1:

• d2p3ya1 first appeared in SCOP 1.75
  
• d2p3ya1 appears in SCOPe 2.07