Lineage for d2omdb_ (2omd B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families) 
Family d.41.5.0: automated matches [191646] (1 protein)
not a true familyProtein automated matches [191185] (7 species)
not a true proteinSpecies Aquifex aeolicus [TaxId:224324] [225400] (1 PDB entry) 
Domain d2omdb_: 2omd B: [205303]
automated match to d2wp4b_
complexed with cl, fmt, gol, na, trs
Details for d2omdb_
PDB Entry: 2omd (more details), 2 Å
PDB Description: Crystal structure of molybdopterin converting factor subunit 2 (aq_2181) from aquifex aeolicus VF5
PDB Compounds: (B:) Molybdopterin-converting factor subunit 2SCOPe Domain Sequences for d2omdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2omdb_ d.41.5.0 (B:) automated matches {Aquifex aeolicus [TaxId: 224324]}
mevgmiprvylghewfgaerilseyqvpedcgaqvlflgiprnapedggniealeyeayp
emaikemekirqetiekfgvkevfihhrlglvkigepsflvlavgghreetfkacryavd
etkkrvpiwkkeifkegkgewvlge
SCOPe Domain Coordinates for d2omdb_:
Click to download the PDB-style file with coordinates for d2omdb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2omdb_:
- d2omdb_ first appeared in SCOPe 2.03
- d2omdb_ appears in SCOPe 2.07
View in 3D
