Lineage for d2omdb_ (2omd B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families) (S)
  5. Family d.41.5.0: automated matches [191646] (1 protein)
    not a true family
  6. Protein automated matches [191185] (7 species)
    not a true protein
  7. Species Aquifex aeolicus [TaxId:224324] [225400] (1 PDB entry)
  8. Domain d2omdb_: 2omd B: [205303]
    automated match to d2wp4b_
    complexed with cl, fmt, gol, na, trs

Details for d2omdb_

PDB Entry: 2omd (more details), 2 Å

PDB Description: Crystal structure of molybdopterin converting factor subunit 2 (aq_2181) from aquifex aeolicus VF5
PDB Compounds: (B:) Molybdopterin-converting factor subunit 2

SCOPe Domain Sequences for d2omdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2omdb_ d.41.5.0 (B:) automated matches {Aquifex aeolicus [TaxId: 224324]}
mevgmiprvylghewfgaerilseyqvpedcgaqvlflgiprnapedggniealeyeayp
emaikemekirqetiekfgvkevfihhrlglvkigepsflvlavgghreetfkacryavd
etkkrvpiwkkeifkegkgewvlge

SCOPe Domain Coordinates for d2omdb_ are not available.

Timeline for d2omdb_:

Domains from other chains:
(mouse over for more information)
d2omda_