Lineage for d2olua2 (2olu A:293-692)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1949287Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1949944Protein Penicillin-binding protein 2, PBP2 [160970] (1 species)
  7. 1949945Species Staphylococcus aureus [TaxId:1280] [160971] (3 PDB entries)
    Uniprot Q2YY56 293-692
  8. 1949946Domain d2olua2: 2olu A:293-692 [148820]
    Other proteins in same PDB: d2olua1
    automated match to d2olva2
    complexed with edo

Details for d2olua2

PDB Entry: 2olu (more details), 2.9 Å

PDB Description: Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme
PDB Compounds: (A:) Penicillin-binding protein 2

SCOPe Domain Sequences for d2olua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2olua2 e.3.1.1 (A:293-692) Penicillin-binding protein 2, PBP2 {Staphylococcus aureus [TaxId: 1280]}
tnqdseynsyvnfvkselmnnkafkdenlgnvlqsgikiytnmdkdvqktlqndvdngsf
yknkdqqvgatildsktgglvaisggrdfkdvvnrnqatdphptgsslkpflaygpaien
mkwatnhaiqdessyqvdgstfrnydtkshgtvsiydalrqsfnipalkawqsvkqnagn
dapkkfaaklglnyegdigpsevlggsasefsptqlasafaaianggtynnahsiqkvvt
rdgetieydhtshkamsdytaymlaemlkgtfkpygsayghgvsgvnmgaktgtgtygae
tysqynlpdnaakdvwingftpqytmsvwmgfskvkqygensfvghsqqeypqflyenvm
skissrdgedfkrpssvsgsipsinvsgsqdnnttnrsth

SCOPe Domain Coordinates for d2olua2:

Click to download the PDB-style file with coordinates for d2olua2.
(The format of our PDB-style files is described here.)

Timeline for d2olua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2olua1