SCOPe 2.08: Domain d2olua2: 2olu A:293-692

Lineage for d2olua2 (2olu A:293-692)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein Penicillin-binding protein 2, PBP2 [160970] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [160971] (3 PDB entries)
   Uniprot Q2YY56 293-692

8. Domain d2olua2: 2olu A:293-692 [148820]
   Other proteins in same PDB: d2olua1
   automated match to d2olva2
   complexed with edo

Details for d2olua2

PDB Entry: 2olu, 2.9 Å

PDB Description: Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme

PDB Compounds: (A:) Penicillin-binding protein 2

SCOPe Domain Sequences for d2olua2:

Sequence; same for both SEQRES and ATOM records:

>d2olua2 e.3.1.1 (A:293-692) Penicillin-binding protein 2, PBP2 {Staphylococcus aureus [TaxId: 1280]}
tnqdseynsyvnfvkselmnnkafkdenlgnvlqsgikiytnmdkdvqktlqndvdngsf
yknkdqqvgatildsktgglvaisggrdfkdvvnrnqatdphptgsslkpflaygpaien
mkwatnhaiqdessyqvdgstfrnydtkshgtvsiydalrqsfnipalkawqsvkqnagn
dapkkfaaklglnyegdigpsevlggsasefsptqlasafaaianggtynnahsiqkvvt
rdgetieydhtshkamsdytaymlaemlkgtfkpygsayghgvsgvnmgaktgtgtygae
tysqynlpdnaakdvwingftpqytmsvwmgfskvkqygensfvghsqqeypqflyenvm
skissrdgedfkrpssvsgsipsinvsgsqdnnttnrsth

Timeline for d2olua2:

• d2olua2 first appeared in SCOP 1.75
  
• d2olua2 appears in SCOPe 2.07