Lineage for d2oc5a1 (2oc5 A:20-241)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703838Family a.25.1.6: PMT1231-like [158402] (2 proteins)
    PfamB PB016165
    automatically mapped to Pfam PF11266
  6. 2703839Protein Hypothetical protein PMT1231 [158403] (1 species)
  7. 2703840Species Prochlorococcus marinus [TaxId:1219] [158404] (8 PDB entries)
    Uniprot Q7V6D4 20-241
  8. 2703845Domain d2oc5a1: 2oc5 A:20-241 [148720]
    complexed with act, fe, unl

Details for d2oc5a1

PDB Entry: 2oc5 (more details), 1.68 Å

PDB Description: crystal structure of a ferritin-like protein (pmt1231) from prochlorococcus marinus str. mit 9313 at 1.68 a resolution
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2oc5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oc5a1 a.25.1.6 (A:20-241) Hypothetical protein PMT1231 {Prochlorococcus marinus [TaxId: 1219]}
ealpdftsdrykdaysrinaiviegeqeahdnyiaigtllpdhveelkrlakmemrhkkg
ftacgknlgveadmdfareffaplrdnfqtalgqgktptclliqallieafaisayhtyi
pvsdpfarkitegvvkdeythlnygeawlkanlescreelleanrenlplirrmldqvag
daavlqmdkedliedfliayqeslteigfntreitrmaaaal

SCOPe Domain Coordinates for d2oc5a1:

Click to download the PDB-style file with coordinates for d2oc5a1.
(The format of our PDB-style files is described here.)

Timeline for d2oc5a1: