Class b: All beta proteins [48724] (176 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.3: Mechanosensitive channel protein MscS (YggB), middle domain [82090] (1 protein) |
Protein Mechanosensitive channel protein MscS (YggB), middle domain [82091] (1 species) forms homoheptameric ring structure very similar to those of the archaeal and eukaryotic Sm proteins |
Species Escherichia coli [TaxId:562] [82092] (2 PDB entries) |
Domain d2oaua1: 2oau A:113-179 [138978] Other proteins in same PDB: d2oaua2, d2oaua3, d2oaub2, d2oaub3, d2oauc2, d2oauc3, d2oaud2, d2oaud3, d2oaue2, d2oaue3, d2oauf2, d2oauf3, d2oaug2, d2oaug3 automatically matched to d1mxma1 |
PDB Entry: 2oau (more details), 3.7 Å
SCOPe Domain Sequences for d2oaua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oaua1 b.38.1.3 (A:113-179) Mechanosensitive channel protein MscS (YggB), middle domain {Escherichia coli [TaxId: 562]} gslsnlaagvllvmfrpfrageyvdlggvagtvlsvqifsttmrtadgkiivipngkiia gniinfs
Timeline for d2oaua1: