Lineage for d2o98a_ (2o98 A:)
- Root: SCOPe 2.02
Class a: All alpha proteins [46456] (284 folds) 
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelixSuperfamily a.118.7: 14-3-3 protein [48445] (1 family) 
Family a.118.7.1: 14-3-3 protein [48446] (5 proteins) Protein automated matches [190238] (4 species)
not a true protein
Species Tobacco (Nicotiana tabacum) [TaxId:4097] [187162] (2 PDB entries) 
Domain d2o98a_: 2o98 A: [138950]
automated match to d1o9ca_
complexed with fsc, so4
Details for d2o98a_
PDB Entry: 2o98 (more details), 2.7 Å
PDB Description: structure of the 14-3-3 / h+-atpase plant complex
PDB Compounds: (A:) 14-3-3-like protein cSCOPe Domain Sequences for d2o98a_:
Sequence, based on SEQRES records: (download)
>d2o98a_ a.118.7.1 (A:) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
avaptareenvymaklaeqaeryeemvefmekvsnslgseeltveernllsvayknviga
rraswriissieqkeesrgneehvnsireyrskienelskicdgilklldaklipsaasg
dskvfylkmkgdyhrylaefktgaerkeaaestltaykaaqdiattelapthpirlglal
nfsvfyyeilnspdracnlakqafdeaiaeldtlgeesykdstlimqllrdnltlwtsdm
Sequence, based on observed residues (ATOM records): (download)
>d2o98a_ a.118.7.1 (A:) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
avaptareenvymaklaeqaeryeemvefmekvsnslgseeltveernllsvayknviga
rraswriissieqkeesrgneehvnsireyrskienelskicdgilklldaklipsaasg
dskvfylkmkgdyhrylaefktgaerkeaaestltaykaaqdiattelapthpirlglal
nfsvfyyeilnspdracnlakqafdeaiaelsykdstlimqllrdnltlwtsdm
SCOPe Domain Coordinates for d2o98a_:
Click to download the PDB-style file with coordinates for d2o98a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2o98a_:
- d2o98a_ first appeared in SCOP 1.73, called d2o98a1
- d2o98a_ appears in SCOPe 2.01
- d2o98a_ appears in SCOPe 2.03
- d2o98a_ appears in the current release, SCOPe 2.08
View in 3D
