Lineage for d2o8ra3 (2o8r A:318-505)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) (S)
  5. Family d.136.1.4: Polyphosphate kinase C-terminal domain [143860] (1 protein)
    C-terminal part of Pfam PF02503; similar to PLD; contains two domains of this fold arranged as in the Nuc dimer
  6. Protein Polyphosphate kinase, PPK [143861] (2 species)
  7. Species Porphyromonas gingivalis [TaxId:837] [143862] (1 PDB entry)
    Uniprot Q7MTR1 318-505! Uniprot Q7MTR1 506-691
  8. Domain d2o8ra3: 2o8r A:318-505 [138935]
    Other proteins in same PDB: d2o8ra1, d2o8ra2, d2o8rb1, d2o8rb2
    complexed with so4

Details for d2o8ra3

PDB Entry: 2o8r (more details), 2.7 Å

PDB Description: crystal structure of polyphosphate kinase from porphyromonas gingivalis
PDB Compounds: (A:) Polyphosphate kinase

SCOPe Domain Sequences for d2o8ra3:

Sequence, based on SEQRES records: (download)

>d2o8ra3 d.136.1.4 (A:318-505) Polyphosphate kinase, PPK {Porphyromonas gingivalis [TaxId: 837]}
ltpepllskhleqapslmegirrkdylihvpyytydyvvrllmeaaispdvseirltqyr
vaenssiisaleaaaqsgkkvsvfvelkarfdeennlrlsermrrsgirivysmpglkvh
aktalilyhtpagerpqgiallstgnfnettariysdttlmtantdivhdvyrlfrildg
dpeparfs

Sequence, based on observed residues (ATOM records): (download)

>d2o8ra3 d.136.1.4 (A:318-505) Polyphosphate kinase, PPK {Porphyromonas gingivalis [TaxId: 837]}
ltpepllskhleqapslmegirrkdylihvpyytydyvvrllmeaaispdvseirltqyr
vaenssiisaleaaaqsgkkvsvfvelkarfnlrlsermrrsgirivysmpglkvhakta
lilyhtpagerpqgiallstgnfnettariysdttlmtantdivhdvyrlfrildgdpep
arfs

SCOPe Domain Coordinates for d2o8ra3 are not available.

Timeline for d2o8ra3:

View in 3D
Domains from same chain:
(mouse over for more information)
d2o8ra1, d2o8ra2, d2o8ra4
View in 3D
Domains from other chains:
(mouse over for more information)
d2o8rb1, d2o8rb2, d2o8rb3, d2o8rb4