Lineage for d2o0qa1 (2o0q A:2-114)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.166: ADP-ribosylation [56398] (1 superfamily)
unusual foldSuperfamily d.166.1: ADP-ribosylation [56399] (8 families) 
Family d.166.1.7: CC0527-like [143950] (1 protein)
Pfam PF06108; DUF952Protein Hypothetical protein CC0527 [143951] (1 species) Species Caulobacter crescentus [TaxId:155892] [143952] (3 PDB entries)
Uniprot Q9AAR9 2-114
Domain d2o0qa1: 2o0q A:2-114 [138867]
Other proteins in same PDB: d2o0qa2
Details for d2o0qa1
PDB Entry: 2o0q (more details), 1.8 Å
PDB Description: X-ray Crystal Structure of Protein CC0527 from Caulobacter crescentus. Northeast Structural Genomics Consortium Target CcR55
PDB Compounds: (A:) Hypothetical protein CC0527SCOPe Domain Sequences for d2o0qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o0qa1 d.166.1.7 (A:2-114) Hypothetical protein CC0527 {Caulobacter crescentus [TaxId: 155892]}
tliykilsraewdaakaqgrfegsavdladgfihlsageqaqetaakwfrgqanlvllav
eaeplgedlkweasrggarfphlyrpllvsevtreadldldadgvpqlgdhla
SCOPe Domain Coordinates for d2o0qa1:
Click to download the PDB-style file with coordinates for d2o0qa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2o0qa1:
- d2o0qa1 first appeared in SCOP 1.73
- d2o0qa1 appears in SCOPe 2.07
View in 3D
