Lineage for d2o0qa1 (2o0q A:2-114)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737530Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 737531Superfamily d.166.1: ADP-ribosylation [56399] (7 families) (S)
  5. 737717Family d.166.1.7: CC0527-like [143950] (1 protein)
    Pfam PF06108; DUF952
  6. 737718Protein Hypothetical protein CC0527 [143951] (1 species)
  7. 737719Species Caulobacter crescentus [TaxId:155892] [143952] (2 PDB entries)
  8. 737720Domain d2o0qa1: 2o0q A:2-114 [138867]

Details for d2o0qa1

PDB Entry: 2o0q (more details), 1.8 Å

PDB Description: X-ray Crystal Structure of Protein CC0527 from Caulobacter crescentus. Northeast Structural Genomics Consortium Target CcR55
PDB Compounds: (A:) Hypothetical protein CC0527

SCOP Domain Sequences for d2o0qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o0qa1 d.166.1.7 (A:2-114) Hypothetical protein CC0527 {Caulobacter crescentus [TaxId: 155892]}
tliykilsraewdaakaqgrfegsavdladgfihlsageqaqetaakwfrgqanlvllav
eaeplgedlkweasrggarfphlyrpllvsevtreadldldadgvpqlgdhla

SCOP Domain Coordinates for d2o0qa1:

Click to download the PDB-style file with coordinates for d2o0qa1.
(The format of our PDB-style files is described here.)

Timeline for d2o0qa1: