Lineage for d2lwpa_ (2lwp A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931211Protein Bag-family molecular chaperone regulator-1 [142932] (2 species)
  7. 2931214Species Mouse (Mus musculus) [TaxId:10090] [255463] (2 PDB entries)
  8. 2931215Domain d2lwpa_: 2lwp A: [243018]
    automated match to d1wxva1

Details for d2lwpa_

PDB Entry: 2lwp (more details)

PDB Description: The NMR solution structure of the the ubiquitin homology domain of mouse BAG-1
PDB Compounds: (A:) BAG family molecular chaperone regulator 1

SCOPe Domain Sequences for d2lwpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lwpa_ d.15.1.1 (A:) Bag-family molecular chaperone regulator-1 {Mouse (Mus musculus) [TaxId: 10090]}
makteemvqteemetprlsvivthsnerydllvtpqqgnsepvvqdlaqlveeatgvplp
fqklifkgkslkemetplsalgmqngcrvmligeksn

SCOPe Domain Coordinates for d2lwpa_:

Click to download the PDB-style file with coordinates for d2lwpa_.
(The format of our PDB-style files is described here.)

Timeline for d2lwpa_: