Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (2 families) common fold is elaborated with additional secondary structures |
Family d.58.28.1: Peptide methionine sulfoxide reductase [55069] (2 proteins) |
Protein Peptide methionine sulfoxide reductase [55070] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [255417] (2 PDB entries) |
Domain d2l90a_: 2l90 A: [242811] automated match to d1fvab_ complexed with myr |
PDB Entry: 2l90 (more details)
SCOPe Domain Sequences for d2l90a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l90a_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Mouse (Mus musculus) [TaxId: 10090]} gdsaskvisaeealpgrtepipvtakhhvsgnrtvepfpegtqmavfgmgcfwgaerkfw vlkgvystqvgfagghtrnptykevcsektghaevvrvvyrpehisfeellkvfwenhdp tqgmrqgndfgtqyrsavyptsavqmeaalrskeeyqkvlskhnfgpittdiregqvfyy aedyhqqylsknpdgycglggtgvscpmaikk
Timeline for d2l90a_: