PDB entry 2l90

View 2l90 on RCSB PDB site
Description: Solution structure of murine myristoylated msrA
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2011-01-27, released 2012-01-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-08-01, with a file datestamp of 2012-07-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptide methionine sulfoxide reductase
    Species: Mus musculus [TaxId:10090]
    Gene: msrA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2l90a_
  • Heterogens: MYR

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2l90A (A:)
    gdsaskvisaeealpgrtepipvtakhhvsgnrtvepfpegtqmavfgmgcfwgaerkfw
    vlkgvystqvgfagghtrnptykevcsektghaevvrvvyrpehisfeellkvfwenhdp
    tqgmrqgndfgtqyrsavyptsavqmeaalrskeeyqkvlskhnfgpittdiregqvfyy
    aedyhqqylsknpdgycglggtgvscpmaikk