Lineage for d2kmka_ (2kmk A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035157Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 3035158Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 3035526Family g.37.1.0: automated matches [196454] (1 protein)
    not a true family
  6. 3035527Protein automated matches [196455] (4 species)
    not a true protein
  7. 3035542Species Norway rat (Rattus norvegicus) [TaxId:10116] [255360] (1 PDB entry)
  8. 3035543Domain d2kmka_: 2kmk A: [242565]
    automated match to d2wbsa_
    protein/DNA complex; complexed with zn

Details for d2kmka_

PDB Entry: 2kmk (more details)

PDB Description: gfi-1 zinc fingers 3-5 complexed with dna
PDB Compounds: (A:) Zinc finger protein Gfi-1

SCOPe Domain Sequences for d2kmka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kmka_ g.37.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sfdckicgksfkrsstlsthllihsdtrpypcqycgkrfhqksdmkkhtfihtgekphkc
qvcgkafsqssnlithsrkhtg

SCOPe Domain Coordinates for d2kmka_:

Click to download the PDB-style file with coordinates for d2kmka_.
(The format of our PDB-style files is described here.)

Timeline for d2kmka_: