Lineage for d2jo6a1 (2jo6 A:1-108)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309647Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1309648Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1309825Family b.33.1.3: NirD-like [158991] (1 protein)
    retains the common fold but lacks the Fe-S cluster
    automatically mapped to Pfam PF13806
  6. 1309826Protein NADH-nitrite reductase small subunit NirD [158992] (3 species)
  7. 1309829Species Escherichia coli [TaxId:562] [158993] (1 PDB entry)
    Uniprot P0A9I8 1-108
  8. 1309830Domain d2jo6a1: 2jo6 A:1-108 [148154]

Details for d2jo6a1

PDB Entry: 2jo6 (more details)

PDB Description: nmr structure of the e.coli protein nird, northeast structural genomics target et100
PDB Compounds: (A:) Nitrite reductase [NAD(P)H] small subunit

SCOPe Domain Sequences for d2jo6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jo6a1 b.33.1.3 (A:1-108) NADH-nitrite reductase small subunit NirD {Escherichia coli [TaxId: 562]}
msqwkdickiddilpetgvcallgdeqvaifrpyhsdqvfaisnidpffessvlsrglia
ehqgelwvasplkkqrfrlsdglcmedeqfsvkhyearvkdgvvqlrg

SCOPe Domain Coordinates for d2jo6a1:

Click to download the PDB-style file with coordinates for d2jo6a1.
(The format of our PDB-style files is described here.)

Timeline for d2jo6a1: