![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
![]() | Family b.33.1.3: NirD-like [158991] (1 protein) retains the common fold but lacks the Fe-S cluster automatically mapped to Pfam PF13806 |
![]() | Protein NADH-nitrite reductase small subunit NirD [158992] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [158993] (1 PDB entry) Uniprot P0A9I8 1-108 |
![]() | Domain d2jo6a1: 2jo6 A:1-108 [148154] Other proteins in same PDB: d2jo6a2 |
PDB Entry: 2jo6 (more details)
SCOPe Domain Sequences for d2jo6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jo6a1 b.33.1.3 (A:1-108) NADH-nitrite reductase small subunit NirD {Escherichia coli [TaxId: 562]} msqwkdickiddilpetgvcallgdeqvaifrpyhsdqvfaisnidpffessvlsrglia ehqgelwvasplkkqrfrlsdglcmedeqfsvkhyearvkdgvvqlrg
Timeline for d2jo6a1: