SCOPe 2.08: Domain d2jo6a1: 2jo6 A:1-108

Lineage for d2jo6a1 (2jo6 A:1-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.3: NirD-like [158991] (1 protein)
   retains the common fold but lacks the Fe-S cluster
   automatically mapped to Pfam PF13806

6. Protein NADH-nitrite reductase small subunit NirD [158992] (3 species)

7. Species Escherichia coli [TaxId:562] [158993] (1 PDB entry)
   Uniprot P0A9I8 1-108

8. Domain d2jo6a1: 2jo6 A:1-108 [148154]
   Other proteins in same PDB: d2jo6a2

Details for d2jo6a1

PDB Entry: 2jo6

PDB Description: nmr structure of the e.coli protein nird, northeast structural genomics target et100

PDB Compounds: (A:) Nitrite reductase [NAD(P)H] small subunit

SCOPe Domain Sequences for d2jo6a1:

Sequence; same for both SEQRES and ATOM records:

>d2jo6a1 b.33.1.3 (A:1-108) NADH-nitrite reductase small subunit NirD {Escherichia coli [TaxId: 562]}
msqwkdickiddilpetgvcallgdeqvaifrpyhsdqvfaisnidpffessvlsrglia
ehqgelwvasplkkqrfrlsdglcmedeqfsvkhyearvkdgvvqlrg

Timeline for d2jo6a1:

• d2jo6a1 first appeared in SCOP 1.75
  
• d2jo6a1 appears in SCOPe 2.07