| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (58 species) not a true protein |
| Species Pyrococcus furiosus [TaxId:2261] [187908] (4 PDB entries) |
| Domain d2jd60_: 2jd6 0: [166011] automated match to d1vlga_ complexed with fe, so4 |
PDB Entry: 2jd6 (more details), 2.75 Å
SCOPe Domain Sequences for d2jd60_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jd60_ a.25.1.0 (0:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
Timeline for d2jd60_:
View in 3DDomains from other chains: (mouse over for more information) d2jd61_, d2jd62_, d2jd63_, d2jd64_, d2jd65_, d2jd66_, d2jd67_, d2jd68_, d2jd69_, d2jd6a_, d2jd6b_, d2jd6c_, d2jd6d_, d2jd6e_, d2jd6f_, d2jd6g_, d2jd6h_, d2jd6i_, d2jd6j_, d2jd6k_, d2jd6l_, d2jd6m_, d2jd6n_, d2jd6o_, d2jd6p_, d2jd6q_, d2jd6r_, d2jd6s_, d2jd6t_, d2jd6u_, d2jd6v_, d2jd6w_, d2jd6x_, d2jd6y_, d2jd6z_ |