Lineage for d2it9a1 (2it9 A:1-122)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
helix-swapped dimer of beta(4)-alpha motifsSuperfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families) 
Family d.18.1.3: PMN2A0962/syc2379c-like [143038] (2 proteins)
Pfam PF08848; DUF1818; specific to cyanobacteria; single-chain domain made of two repeats of this structural motifProtein Hypothetical protein PMN2A_0962 [143039] (1 species) Species Prochlorococcus marinus [TaxId:1219] [143040] (1 PDB entry)
Uniprot Q46J75 1-122
Domain d2it9a1: 2it9 A:1-122 [137634]
Other proteins in same PDB: d2it9a2
complexed with cl, edo, pge, trs
Details for d2it9a1
PDB Entry: 2it9 (more details), 1.8 Å
PDB Description: crystal structure of a protein with unknown function from duf155 family (yp_292156.1) from prochlorococcus sp. natl2a at 1.80 a resolution
PDB Compounds: (A:) hypothetical proteinSCOPe Domain Sequences for d2it9a1:
Sequence, based on SEQRES records: (download)
>d2it9a1 d.18.1.3 (A:1-122) Hypothetical protein PMN2A_0962 {Prochlorococcus marinus [TaxId: 1219]}
mikkegpgwriifdssrdnfstliggetwaieldksewkilvevvmelcdqyklvkeqlm
gdeditlelerrpwlailngdqygwnlrlilsasglfnrgaevywprhvtnnvvnamrsm
wd
Sequence, based on observed residues (ATOM records): (download)
>d2it9a1 d.18.1.3 (A:1-122) Hypothetical protein PMN2A_0962 {Prochlorococcus marinus [TaxId: 1219]}
mikkegpgwriifdssrdnfstliggetwaieldksewkilvevvmelcdqyklvkeqlm
gdeditlelerrpwlailngdqygwnlrlilsafnrgaevywprhvtnnvvnamrsmwd
SCOPe Domain Coordinates for d2it9a1:
Click to download the PDB-style file with coordinates for d2it9a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2it9a1:
- d2it9a1 first appeared in SCOP 1.73
- d2it9a1 appears in SCOPe 2.05
- d2it9a1 appears in SCOPe 2.07
- d2it9a1 appears in the current release, SCOPe 2.08
View in 3D
