| Class b: All beta proteins [48724] (176 folds) |
| Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) ![]() |
| Family b.3.4.0: automated matches [191441] (1 protein) not a true family |
| Protein automated matches [190651] (7 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [188214] (1 PDB entry) |
| Domain d2igla_: 2igl A: [165540] automated match to d1tfpa_ |
PDB Entry: 2igl (more details), 1.8 Å
SCOPe Domain Sequences for d2igla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2igla_ b.3.4.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
hmaqqnilsvhilnqqtgkpaadvtvtlekkadngwlqlntaktdkdgrikalwpeqtat
tgdyrvvfktgdyfkkqnlesffpeipvefhinkvnehyhvplllsqygystyrgs
Timeline for d2igla_: