SCOPe 2.08: Domain d2igla1: 2igl A:24-137

Lineage for d2igla1 (2igl A:24-137)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.0: automated matches [191441] (1 protein)
   not a true family

6. Protein automated matches [190651] (8 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [188214] (1 PDB entry)

8. Domain d2igla1: 2igl A:24-137 [165540]
   Other proteins in same PDB: d2igla2, d2iglb2, d2iglc2, d2igld2
   automated match to d1tfpa_

Details for d2igla1

PDB Entry: 2igl, 1.8 Å

PDB Description: Crystal Structure of E. coli YEDX, a transthyretin related protein

PDB Compounds: (A:) transthyretin-like protein

SCOPe Domain Sequences for d2igla1:

Sequence; same for both SEQRES and ATOM records:

>d2igla1 b.3.4.0 (A:24-137) automated matches {Escherichia coli K-12 [TaxId: 83333]}
aqqnilsvhilnqqtgkpaadvtvtlekkadngwlqlntaktdkdgrikalwpeqtattg
dyrvvfktgdyfkkqnlesffpeipvefhinkvnehyhvplllsqygystyrgs

Timeline for d2igla1:

• d2igla1 first appeared in SCOPe 2.01, called d2igla_
  
• d2igla1 appears in SCOPe 2.07