Lineage for d2i15a1 (2i15 A:1-129)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2352226Fold a.291: MG296-like [158714] (1 superfamily)
    multihelical; in crystal forms helical polymers by swapping the two N-terminal helices to the next subunit in polymer; three subunits per turn of polymer helix
  4. 2352227Superfamily a.291.1: MG296-like [158715] (1 family) (S)
    automatically mapped to Pfam PF09644
  5. 2352228Family a.291.1.1: MG296-like [158716] (1 protein)
    Pfam PF09644
  6. 2352229Protein Hypothetical protein MPN423 [158717] (1 species)
    MG296 homologue
  7. 2352230Species Mycoplasma pneumoniae [TaxId:2104] [158718] (1 PDB entry)
    Uniprot P75364 1-129
  8. 2352231Domain d2i15a1: 2i15 A:1-129 [147485]

Details for d2i15a1

PDB Entry: 2i15 (more details), 2.4 Å

PDB Description: crystal structure of mpn423 from mycoplasma pneumoniae
PDB Compounds: (A:) Hypothetical protein MG296 homolog

SCOPe Domain Sequences for d2i15a1:

Sequence, based on SEQRES records: (download)

>d2i15a1 a.291.1.1 (A:1-129) Hypothetical protein MPN423 {Mycoplasma pneumoniae [TaxId: 2104]}
mkpqllalkqfvqtefekvdfetfrqnfnrclereqstlliyedddyddqsfflkpmlsd
affissevvkqldllavlvdnpkgdvksccqsfyealtlfisalaitkgvdvgryhqqlg
krfgvltvy

Sequence, based on observed residues (ATOM records): (download)

>d2i15a1 a.291.1.1 (A:1-129) Hypothetical protein MPN423 {Mycoplasma pneumoniae [TaxId: 2104]}
mkpqllalkqfvqtefekvdfetfrqnfnrclereqstlliyedddyddqsfflkpmlsd
affissevvkqldlpkgdvksccqsfyealtlfisalaitkgvdvgryhqqlgkrfgvlt
vy

SCOPe Domain Coordinates for d2i15a1:

Click to download the PDB-style file with coordinates for d2i15a1.
(The format of our PDB-style files is described here.)

Timeline for d2i15a1: