Lineage for d2hqxa1 (2hqx A:8-97)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) 
Family b.34.9.1: Tudor domain [63749] (9 proteins)
Pfam PF00567
Protein P100 co-activator, SND1 [141207] (1 species) Species Human (Homo sapiens) [TaxId:9606] [141208] (3 PDB entries)
Uniprot Q7KZF4 705-794
Domain d2hqxa1: 2hqx A:8-97 [136675]
has additional insertions and/or extensions that are not grouped together
Details for d2hqxa1
PDB Entry: 2hqx (more details), 1.42 Å
PDB Description: Crystal structure of human P100 tudor domain conserved region
PDB Compounds: (A:) p100 co-activator tudor domainSCOPe Domain Sequences for d2hqxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hqxa1 b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]}
tqfqklmenmrndiashppvegsyaprrgefciakfvdgewyrarvekvespakihvfyi
dygnrevlpstrlgtlspafstrvlpaqat
SCOPe Domain Coordinates for d2hqxa1:
Click to download the PDB-style file with coordinates for d2hqxa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hqxa1:
- d2hqxa1 first appeared in SCOP 1.73
- d2hqxa1 appears in SCOPe 2.07
View in 3D
