![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
![]() | Protein Hemagglutinin [49824] (22 species) includes rudiment esterase domain |
![]() | Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries) |
![]() | Domain d2hmga_: 2hmg A: [23828] Other proteins in same PDB: d2hmgb_, d2hmgd_, d2hmgf_ complexed with nag |
PDB Entry: 2hmg (more details), 3 Å
SCOPe Domain Sequences for d2hmga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hmga_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]} qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef itegftwtgvtqnggsnackrgpgsdffsrlnwltksgstypvlnvtmpnndnfdklyiw gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki tygacpkyvkqntlklatgmrnvpekqt
Timeline for d2hmga_: