SCOPe 2.08: Domain d2hmgc_: 2hmg C:

Lineage for d2hmgc_ (2hmg C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (22 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)

8. Domain d2hmgc_: 2hmg C: [23829]
   Other proteins in same PDB: d2hmgb_, d2hmgd_, d2hmgf_
   complexed with nag

Details for d2hmgc_

PDB Entry: 2hmg, 3 Å

PDB Description: refinement of the influenza virus hemagglutinin by simulated annealing

PDB Compounds: (C:) hemagglutinin (ha1 chain)

SCOPe Domain Sequences for d2hmgc_:

Sequence; same for both SEQRES and ATOM records:

>d2hmgc_ b.19.1.2 (C:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
itegftwtgvtqnggsnackrgpgsdffsrlnwltksgstypvlnvtmpnndnfdklyiw
gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
tygacpkyvkqntlklatgmrnvpekqt

Timeline for d2hmgc_:

• d2hmgc_ first appeared (with stable ids) in SCOP 1.55
  
• d2hmgc_ appears in SCOPe 2.07