Lineage for d2hjqa1 (2hjq A:50-103)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778725Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 778764Superfamily a.140.3: Rho N-terminal domain-like [68912] (2 families) (S)
  5. 778803Family a.140.3.2: YqbF C-terminal domain-like [158225] (2 proteins)
  6. 778804Protein Hypothetical protein YqbF [158226] (1 species)
  7. 778805Species Bacillus subtilis [TaxId:1423] [158227] (1 PDB entry)
    Uniprot P45922 50-103
  8. 778806Domain d2hjqa1: 2hjq A:50-103 [147296]
    Other proteins in same PDB: d2hjqa2

Details for d2hjqa1

PDB Entry: 2hjq (more details)

PDB Description: nmr structure of bacillus subtilis protein yqbf, northeast structural genomics target sr449
PDB Compounds: (A:) Hypothetical protein yqbF

SCOP Domain Sequences for d2hjqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hjqa1 a.140.3.2 (A:50-103) Hypothetical protein YqbF {Bacillus subtilis [TaxId: 1423]}
qkddpinyteselkgmnkaehesiisnlgrnpsdfknaderiayilkqidnkge

SCOP Domain Coordinates for d2hjqa1:

Click to download the PDB-style file with coordinates for d2hjqa1.
(The format of our PDB-style files is described here.)

Timeline for d2hjqa1:

778806
d2hjqa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2hjqa2