Lineage for d2hhma_ (2hhm A:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1691917Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 1691918Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 1691919Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 1692100Protein Inositol monophosphatase [56663] (1 species)
  7. 1692101Species Human (Homo sapiens) [TaxId:9606] [56664] (9 PDB entries)
  8. 1692104Domain d2hhma_: 2hhm A: [42955]
    complexed with gd, so4

Details for d2hhma_

PDB Entry: 2hhm (more details), 2.1 Å

PDB Description: structure of inositol monophosphatase, the putative target of lithium therapy
PDB Compounds: (A:) inositol monophosphatase

SCOPe Domain Sequences for d2hhma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hhma_ e.7.1.1 (A:) Inositol monophosphatase {Human (Homo sapiens) [TaxId: 9606]}
wqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikekyps
hsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgvvys
cvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmeklfc
ipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtggpfd
lmsrrviaannrilaeriakeiqviplqrdde

SCOPe Domain Coordinates for d2hhma_:

Click to download the PDB-style file with coordinates for d2hhma_.
(The format of our PDB-style files is described here.)

Timeline for d2hhma_: